PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E01219.1.p
Common NameEUGRSUZ_E01219
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family FAR1
Protein Properties Length: 614aa    MW: 71287.9 Da    PI: 8.1441
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E01219.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR162.89.9e-201396390
              FAR1  3 YneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90
                      Y +YA   GF vrksk +k+ ++geit+rtfvC++eg++ +++++  +++ ++ e r+gC a ++ k e +g +ev++ + +HnHe+ 
  Eucgr.E01219.1.p 13 YVAYAIGKGFGVRKSKIRKN-DKGEITRRTFVCNCEGYAINSSDQ--ERKYEKLEVRCGCPAFIRFKVE-NGSYEVIDYVPKHNHEFI 96
                      99**************9999.8888**************999877..8888999**************9.***************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.4E-171396IPR004330FAR1 DNA binding domain
PfamPF105514.6E-33218312IPR018289MULE transposase domain
PROSITE profilePS509668.333498534IPR007527Zinc finger, SWIM-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 614 aa     Download sequence    Send to blast
MVFASELEAY HKYVAYAIGK GFGVRKSKIR KNDKGEITRR TFVCNCEGYA INSSDQERKY  60
EKLEVRCGCP AFIRFKVENG SYEVIDYVPK HNHEFIPEHQ RHLIRCGRMI SDTCKGVLVD  120
MAKAGIGGTT AYKFLANEAG GSQNLGFILR DCQNFLQGER LNYIERGDCQ SLLNHFHCMQ  180
MQNPMFFYAQ QVDQDGRLTN LFWRDSLSKF DYDCFGDVMV FDTTYRTNMY SLICAPFVGV  240
NHHWKNTLFG CAFLLDETAD SFIWLFEVFL KSMGNKAPKT IFTDQDHAMA KAIQIVFPNT  300
QHRLCTWHIE KNANKNIPHL YQKSRFKDKY FSRLMYKCKS EDEFESTWRK MQEEWDTENN  360
SWLQRLYDLR HKWSSAFGRD IFSCGIKSSQ RSESTNNVFQ QFSKKTSTLI QFVHYYEEQL  420
KHMREIENQD DYSSRGTPRL QISYNGILTH AASVYTRAIF GRFYEEFLQS LSEKISGTTF  480
DGFIYEYTLK CDGIQSEHVV RFNPTDFSVS CECKLFESKG WLCRHALHIL NGNISVSAIP  540
SSYILKRWTK GAKQGYVNDE SHEISPGPST FNRFSVLMQS AFEVMSLGAQ DENTMRIVKK  600
NLKVAVAEIA SYNS
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E01219.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010056981.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A059C3I90.0A0A059C3I9_EUCGR; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM11826253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-113FAR1-related sequence 5